PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01035.1_g00007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family TALE
Protein Properties Length: 452aa    MW: 50081.1 Da    PI: 6.5114
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01035.1_g00007.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.31.1e-073894222154
                              HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                 Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                              k +yp++e++++L +++gL+ +q+ +WF N+R +
  Rsa1.0_01035.1_g00007.1 389 KWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 422
                              469*****************************87 PP

2ELK28.73e-10343364122
                      ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                              ELKh+L+++Y+++++++++E++
  Rsa1.0_01035.1_g00007.1 343 ELKHELKQGYKEKIVDIREEIL 364
                              9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.6E-19177221IPR005540KNOX1
PfamPF037901.2E-17180220IPR005540KNOX1
SMARTSM012562.0E-29233288IPR005541KNOX2
PfamPF037913.0E-21237287IPR005541KNOX2
PfamPF037891.1E-6343364IPR005539ELK domain
SMARTSM011886.1E-4343364IPR005539ELK domain
PROSITE profilePS512139.969343363IPR005539ELK domain
PROSITE profilePS5007111.726363426IPR001356Homeobox domain
SMARTSM003892.4E-11365430IPR001356Homeobox domain
SuperFamilySSF466895.56E-16365429IPR009057Homeodomain-like
CDDcd000866.66E-12366427No hitNo description
Gene3DG3DSA:1.10.10.603.9E-25370427IPR009057Homeodomain-like
PfamPF059201.3E-17383422IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009416Biological Processresponse to light stimulus
GO:0009722Biological Processdetection of cytokinin stimulus
GO:0071345Biological Processcellular response to cytokine stimulus
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 452 aa     Download sequence    Send to blast
MAFHQNHHLS QDLSFNHFTD QHQPPPPQPP PQQQQHFHDA TPPPNWLNTA LLRSDNNNNN  60
NNFLNLHTTT ANNATAASSS DSPSSAAAIA ANQWLSRSSS FLQRTGNNNN XAIAANQWLS  120
RSSSFLQRTG NNNNNNAVVG DVIDDVTGGG GGAEQMMSGG ENKNDGGGDG VVSWQNARHK  180
AEILSHPLYE QLLSAHVACL RIATPVDQLP RIDAQLAQSQ HVIAKYSTLG AGGQGLVGDD  240
KELDQFMTHY VLLLCSFKEQ LQQHVRVHAM EAVMACWEIE QSLQSLTGVS PGEGMGATMS  300
DDEDEQVESD ANMFDGGGLD VLGFGPLIPT ESERSLMERV RQELKHELKQ GYKEKIVDIR  360
EEILRKRRAG KLPGDTTSVL KAWWQSHSKW PYPTEEDKAR LVQETGLQLK QINNWFINQR  420
KRNWHSNPSS STVLKNKRKS NAGDNSGRER FT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A1e-12366430872Homeobox protein PKNOX1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3529660.0AK352966.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-12-H10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013706486.10.0PREDICTED: homeobox protein knotted-1-like 3 isoform X1
RefseqXP_013598002.10.0PREDICTED: homeobox protein knotted-1-like 3
SwissprotP480000.0KNAT3_ARATH; Homeobox protein knotted-1-like 3
TrEMBLA0A0D3DCW50.0A0A0D3DCW5_BRAOL; Uncharacterized protein
STRINGAT5G25220.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM44428158
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.10.0KNOTTED1-like homeobox gene 3